PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_FAFED0328.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 460aa    MW: 48335.4 Da    PI: 9.6001
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_FAFED0328.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.31.6e-08186248163
                            XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            eke kr rr   NRe+Ar   +R++a  +eL++kv+ L ++N+ +kke ++  +++ +lk  +
  Traes_4DS_FAFED0328.2 186 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLASQNENMKKEKDMVLEQYLTLKETN 248
                            89*******************************************************999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-10186250IPR004827Basic-leucine zipper domain
PfamPF001704.3E-7186248IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.657188251IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.72E-6190244No hitNo description
Gene3DG3DSA:1.20.5.1706.2E-4190246No hitNo description
CDDcd147024.82E-14191241No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MLPIRPQRRR CTVPPVRGPR AASGERIFKA GAGAXPPYSR LAPLSALRSR SHPILAAPPM  60
PTDHGGSSDG GHQAQCRHRG ASVDVELRAA MALADMAGAG AGAAADHALP AQHLRHAAAP  120
AAQAAMEQED EELASTRLSL ELGNVGIQSS PCSSSSSGAG QQPPQSSAAV TGYGLSRPRH  180
MLTEAEKEAK RLRRVLANRE SARQTILRRQ AIRDELARKV ADLASQNENM KKEKDMVLEQ  240
YLTLKETNKQ LKQQVAKTTK KKPSSTPAIT PMDIAPPAQS AEATPPQTPP QPSFLYSAPP  300
TSMPVPYVWG SWPPCGPGVY EHGGNPAGMA GHAPPPLCVP PACAWYYPVV AAATDPRGSP  360
PAYVQPFQEP TGSGGTAGED TDDDPCSLTL AIDAADKKSP AACPNAYQSG SGVVGAVGLQ  420
VALSGREKAA TAAEARKRRK ELTKLKQMHA GSRHGAGEHW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1435440RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3596220.0AK359622.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1100C17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615785.11e-104PREDICTED: translation initiation factor IF-2
TrEMBLW5EU110.0W5EU11_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.17e-18bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]